Anti-Zinc finger protein 251 antibody
| Name | Anti-Zinc finger protein 251 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab85493 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 180-229 ( GKELWVLNLLGAEEPDILKSCQKDSEVGTKKELSILNQKFSEEVKTPEFV ) of human Zinc finger protein 251 (XP_942907) |
| Description | Rabbit Polyclonal |
| Gene | ZNF251 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Zinc finger protein 251 antibody (ab85493) at 1 µg/ml (in 5% skim milk / PBS buffer) + human fetal muscle lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution