Anti-Zinc finger protein 460 antibody
| Name | Anti-Zinc finger protein 460 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab85001 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 36-85 ( ALYVEVMLETCGLLVALGDSTKPETVEPIPSHLALPEEVSLQEQLAQGVP ) of Human Zinc finger protein 460 (NP_006626) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | ZNF460 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Zinc finger protein 460 antibody (ab85001) at 1 µg/ml + OVCAR-3 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution