Anti-Zmat2 antibody
| Name | Anti-Zmat2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab108076 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within amino acids 174-199 (KEKQKEKKRRAEEDLTFEEDDEMAAVMGFSGFGSTKKSY) of Human Zmat2 (NP_653324) |
| Description | Rabbit Polyclonal |
| Gene | ZMAT2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Zmat2 antibody (ab108076) at 1 µg/ml + 721_B cell lysate at 10 µg