Name | Anti-ZNF154 antibody |
---|---|
Supplier | Abcam |
Catalog | ab87160 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Horse, Chimpanzee |
Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 36-85 ( RCLYRDVMLENLALLTSLDVHHQKQHLGEKHFRSNVGRALFVKTCTFHVS ) of Human ZNF154 (NP_001078853) |
Description | Rabbit Polyclonal |
Gene | ZNF154 |
Conjugate | Unconjugated |
Supplier Page | Shop |