Anti-ZNF154 antibody
| Name | Anti-ZNF154 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab87160 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Horse, Chimpanzee |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 36-85 ( RCLYRDVMLENLALLTSLDVHHQKQHLGEKHFRSNVGRALFVKTCTFHVS ) of Human ZNF154 (NP_001078853) |
| Description | Rabbit Polyclonal |
| Gene | ZNF154 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ZNF154 antibody (ab87160) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal brain lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution