Anti-ZNF165 antibody
| Name | Anti-ZNF165 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab86360 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Human, Pig |
| Antigen | Synthetic peptide corresponding to a region within the internal sequence amino acids 216-265 of Human ZNF165; ISEASGESQDICKSAGRVKRQWEKESGESQRLSSAQDEGFGKILTHKNTV ; NP_003438 Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | ZNF165 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ZNF165 antibody (ab86360) at 1 µg/ml (in 5% skim milk / PBS buffer) + HeLa cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human placenta tissue labelling ZNF165 with ab86360 at 5.0µg/ml.