Anti-ZNF169 antibody
| Name | Anti-ZNF169 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab98918 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within N-terminal amino acids 71-120 ( EPWREENEHLLDLCPEPRTEFQPSFPHLVAFSSSQLLRQYALSGHPTQIF ) of Human ZNF169 (NP_919301) |
| Description | Rabbit Polyclonal |
| Gene | ZNF169 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ZNF169 antibody (ab98918) at 1 µg/ml + Human fetal kidney lysate at 10 µg