Name | Anti-ZNF180 antibody |
---|---|
Supplier | Abcam |
Catalog | ab82965 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | ELISA WB |
Species Reactivities | Human, Rat |
Antigen | Synthetic peptide, corresponding to a region within internal sequence amino acids 287 - 336 (LHIHEKIHGGGKTFDFKECGQVLNPKISHNEQQRIPFEESQYKCSETSH S) of Human zinc finger protein 180 (NP_037388) |
Description | Rabbit Polyclonal |
Gene | ZNF180 |
Conjugate | Unconjugated |
Supplier Page | Shop |