Anti-ZNF180 antibody
| Name | Anti-ZNF180 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab82965 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ELISA WB |
| Species Reactivities | Human, Rat |
| Antigen | Synthetic peptide, corresponding to a region within internal sequence amino acids 287 - 336 (LHIHEKIHGGGKTFDFKECGQVLNPKISHNEQQRIPFEESQYKCSETSH S) of Human zinc finger protein 180 (NP_037388) |
| Description | Rabbit Polyclonal |
| Gene | ZNF180 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ZNF180 antibody (ab82965) at 1 µg/ml + 293T cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution