Anti-ZNF236 antibody
| Name | Anti-ZNF236 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab85453 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog |
| Antigen | A synthetic peptide corresponding to a region within the internal sequence 1079-1128 ( VSATGETEGGDICMEEEEEHSDRNASRKSRPEVITFTEEETAQLAKIRPQ ) of Human ZNF236, NP_031371 Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | ZNF236 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ZNF236 antibody (ab85453) at 1 µg/ml + HepG2 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution