Anti-ZNF248 antibody
| Name | Anti-ZNF248 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab85291 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region from N-terminal amino acids 108-157 ( NKTVSVENGDRGSKTFNLGTDPVSLRNYPYKICDSCEMNLKNISGLIISK ) of human ZNF248 (NP_066383) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | ZNF248 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ZNF248 antibody (ab85291) at 1 µg/ml + HepG2 Cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1: 50,000