Anti-ZNF277 antibody
| Name | Anti-ZNF277 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab108075 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 1-50 (MAASKTQGAVARMQEDRDGSCSTVGGVGYGDSKDCILEPLSLPESPGGT T ) of Human ZNF277 (NP_068834) |
| Description | Rabbit Polyclonal |
| Gene | ZNF277 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ZNF277 antibody (ab108075) at 1 µg/ml + OVCAR-3 cell lysate at 10 µg