Anti-ZNF312B antibody
| Name | Anti-ZNF312B antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab81251 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Human, Rat, Rabbit |
| Antigen | A synthetic peptide corresponding to a region corresponding within C terminal amino acids 397-446 ( CPTCGKGFCRNFDLKKHVRKLHDSSLGLARTPAGEPGTEPPPPLPQQPPM ) of Human ZNF312B (NP_001019784) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | FEZF1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ZNF312B antibody (ab81251) at 1 µg/ml + HeLa cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution
ab81251 at 5 µg/ml staining ZNF312B in Human cerebellum by Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections).
ab81251 at 5 µg/ml staining ZNF312B in Human pancreas by Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections).
ab81251 at 5 µg/ml staining ZNF312B in Human placenta by Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections).