Anti-ZNF366 antibody
| Name | Anti-ZNF366 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab87173 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Cat, Pig |
| Antigen | Synthetic peptide corresponding to a region within the internal sequence amino acids 684-733 (GAEGGQERDCAGRDECLSLRAFQSTRRGPSFSDYLYFKHRDESLKELLE R) of Human ZNF366 (NP_689838) |
| Description | Rabbit Polyclonal |
| Gene | ZNF366 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ZNF366 antibody (ab87173) at 1 µg/ml + 721_B cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution