Anti-ZNF391 antibody
| Name | Anti-ZNF391 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab81370 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human, Bovine, Dog |
| Antigen | Synthetic peptide, corresponding to a region within N terminal amino acids 73-122 QQKIPKGHGSPISRKNSKDNSDLIKHQRLFSQRKPCKCNECEKAFSYQSD of Human ZNF391, NP_001070249 |
| Description | Rabbit Polyclonal |
| Gene | ZNF391 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ZNF391 antibody (ab81370) at 1 µg/ml (in 5% skim milk / PBS buffer) + 721_B cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution