Anti-ZNF431 antibody

Name Anti-ZNF431 antibody
Supplier Abcam
Catalog ab87232
Prices $370.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB IP
Species Reactivities Human
Antigen Synthetic peptide corresponding to a region within N-terminal amino acids 2 - 51 ( DDLKYGVYPLKEASGCPGAERNLLVYSYFEKETLTFRDVAIEFSLEEWEC ) of Human ZNF431 (NP_597730) Run BLAST with Run BLAST with
Description Rabbit Polyclonal
Gene ZNF431
Conjugate Unconjugated
Supplier Page Shop

Product images


Product References