Anti-ZNF431 antibody
| Name | Anti-ZNF431 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab87232 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IP |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within N-terminal amino acids 2 - 51 ( DDLKYGVYPLKEASGCPGAERNLLVYSYFEKETLTFRDVAIEFSLEEWEC ) of Human ZNF431 (NP_597730) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | ZNF431 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ZNF431 antibody (ab87232) at 1 µg/ml + HeLa cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution