Anti-ZNF510 antibody
| Name | Anti-ZNF510 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab86312 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide, corresponding to a region within internal sequence amino acids 612-661 (KAILSDHQRIHTGEKPFQCNKCGKTFGQKSNLRIHQRTHSGEKSYECNE Y) of Human ZNF510 (NP_055745) |
| Description | Rabbit Polyclonal |
| Gene | ZNF510 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ZNF510 antibody (ab86312) at 1 µg/ml + Fetal heart lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution