Anti-ZNF513 antibody
| Name | Anti-ZNF513 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab87552 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within the internal sequence amino acids 468-517 ( GEKPFRCATCAYTTGHWDNYKRHQKVHGHGGAGGPGLSASEGWAPPHSPP ) of Human ZNF513 (NP_653232) |
| Description | Rabbit Polyclonal |
| Gene | ZNF513 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ZNF513 antibody (ab87552) at 1 µg/ml + HT1080 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution