Anti-ZNF565 antibody
| Name | Anti-ZNF565 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab90012 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Rat, Rabbit, Horse, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 432 - 481 ( SQLTHHQRIHTCEKPYECRECGMAFIRSSQLTEHQRIHPGIKPYECRECG ) of Human ZNF565 (NP_689690) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | ZNF565 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ZNF565 antibody (ab90012) at 1 µg/ml (in 5% skim milk / PBS buffer) + human fetal kidney lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution