Anti-ZNF569 antibody
| Name | Anti-ZNF569 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab94699 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Guinea Pig, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 108-157 ( TEEKGNECQKKFANVFPLNSDFFPSRHNLYEYDLFGKCLEHNFDCHNNVK ) of Human ZNF569 (NP_689697) |
| Description | Rabbit Polyclonal |
| Gene | ZNF569 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ZNF569 antibody (ab94699) at 1 µg/ml + HT1080 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution