Anti-ZNF583 antibody
| Name | Anti-ZNF583 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab122929 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse, Rat, Rabbit, Horse, Bovine, Dog, Human, Zebrafish |
| Antigen | Synthetic peptide, corresponding to a region within internal amino acids 271-320 ( ECRKAFSQNAHLAQHQRVHTGEKPYQCKECKKAFSQIAHLTQHQRIHTGE ) of Mouse ZNF583 (NP_001028421) |
| Description | Rabbit Polyclonal |
| Gene | ZNF583 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ZNF583 antibody (ab122929) at 1 µg/ml + Mouse Pancreas lysate at 10 µg