Anti-ZNF585B antibody
| Name | Anti-ZNF585B antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab85640 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide, corresponding to a region within N terminal amino acids 107-156 (RKIIGYKPASSQDQKIYSGEKSYECAEFGKSFTWKSQFKVHLKVPTGEK L) of Human ZNF585B, NP_689492 |
| Description | Rabbit Polyclonal |
| Gene | ZNF585B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ZNF585B antibody (ab85640) at 1 µg/ml + 721_B cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution