Anti-ZNF625 antibody
| Name | Anti-ZNF625 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab87290 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide, corresponding to a region within N terminal amino acids 2-51 (GERLLESKKDHQHGEILTQVPDDMLKKKTPRVKSCGEVSVGHASLNRHH R) of Human ZNF625 (NP_660276) |
| Description | Rabbit Polyclonal |
| Gene | ZNF625 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ZNF625 antibody (ab87290) at 1 µg/ml + Fetal heart lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution