Anti-ZNF708 antibody
| Name | Anti-ZNF708 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab81521 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Bovine, Drosophila, Zebrafish |
| Antigen | Synthetic peptide, corresponding to a region within C terminal amino acids 433-482 (ILTKHKVIHTEDKPYKCEECGKTFNYSSNFTNHKKIHTGEKPYKCEECG K) of Human ZNF708, EAW84891 |
| Description | Rabbit Polyclonal |
| Gene | ZNF708 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ZNF708 antibody (ab81521) at 1 µg/ml (in 5% skim milk / PBS buffer) + fetal liver lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution