Name | Anti-ZNF708 antibody |
---|---|
Supplier | Abcam |
Catalog | ab81521 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB ELISA |
Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Bovine, Drosophila, Zebrafish |
Antigen | Synthetic peptide, corresponding to a region within C terminal amino acids 433-482 (ILTKHKVIHTEDKPYKCEECGKTFNYSSNFTNHKKIHTGEKPYKCEECG K) of Human ZNF708, EAW84891 |
Description | Rabbit Polyclonal |
Gene | ZNF708 |
Conjugate | Unconjugated |
Supplier Page | Shop |