Anti-ZNF74 antibody
| Name | Anti-ZNF74 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab85506 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | A synthetic peptide corresponding to an internal region within amino acids 215-264 (RLCAGENASTPSEPEKFPQVRRQRGAGAGEGEFVCGECGKAFRQSSSLT L) of Human ZNF74 (NP_003417) |
| Description | Rabbit Polyclonal |
| Gene | ZNF74 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ZNF74 antibody (ab85506) at 1 µg/ml + 293T cell lysate at 10 µgSecondaryHRP-conjugated anti-Rabbit IgG at 1/50000 dilution