Anti-ZNF774 antibody
| Name | Anti-ZNF774 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab122137 |
| Prices | $443.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF ICC/IF WB IHC-P |
| Species Reactivities | Human |
| Antigen | antigen sequence: MWLGTSGKSGLPGHCLENPLQECHPAQLEEWALKGISRPSVISQPEQKEE PWVLPLQNFEARKIPRESHTDC , corresponding to amino acids 1-72 of Human ZNF774 Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | ZNF774 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Immunofluorescent staining of Human cell line A-431 shows positivity in cytoplasm and cytoskeleton (intermediate filaments). Recommended concentration of ab122137 1-4 µg/ml. Cells treated with PFA/Triton X-100.
ab122137, at 1/200 dilution, staining ZNF774 in Human colon tissue by Immunohistochemistry using formalin-fixed, paraffin-embedded tissue.
All lanes : Anti-ZNF774 antibody (ab122137) at 1/500 dilutionLane 1 : RT4 cell lysate Lane 2 : U251MG cell lysate Lane 3 : Human PlasmaLane 4 : Human liver tissue lysateLane 5 : Human tonsil tissue lysate