Anti-ZNF781 antibody
| Name | Anti-ZNF781 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab81562 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | Synthetic peptide, corresponding to a regio within N terminal amino acids 1-50 (QRNAMYLKNVAETACNFQLTQYQISHANQKPYECQICGKPFRKRAHLTQ H) of Human ZNF781 |
| Description | Rabbit Polyclonal |
| Gene | ZNF781 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ZNF781 antibody (ab81562) at 1 µg/ml + Fetal Muscle lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution