Name | Anti-ZNF781 antibody |
---|---|
Supplier | Abcam |
Catalog | ab81562 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB ELISA |
Species Reactivities | Human |
Antigen | Synthetic peptide, corresponding to a regio within N terminal amino acids 1-50 (QRNAMYLKNVAETACNFQLTQYQISHANQKPYECQICGKPFRKRAHLTQ H) of Human ZNF781 |
Description | Rabbit Polyclonal |
Gene | ZNF781 |
Conjugate | Unconjugated |
Supplier Page | Shop |