Anti-ZNF79 antibody
| Name | Anti-ZNF79 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab85592 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region from N terminal amino acids 2-51 ( LEEGVLPSPGPALPQEENTGEEGMAAGLLTAGPRGSTFFSSVTVAFAQER ) of Human ZNF79 (NP_009066) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | ZNF79 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ZNF79 antibody (ab85592) at 1 µg/ml (in 5% skim milk / PBS buffer) + Jurkat Cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution