Name | Anti-ZNF8 antibody |
---|---|
Supplier | Abcam |
Catalog | ab90734 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Horse, Bovine, Cat, Dog |
Antigen | A synthetic peptide corresponding to a region within N terminal amino acids 36 - 85 ( QEEWGQLDPTQRILYRDVMLETFGHLLSIGPELPKPEVISQLEQGTELWV ) of Human ZNF8 (NP_066575) Run BLAST with Run BLAST with |
Description | Rabbit Polyclonal |
Gene | ZNF8 |
Conjugate | Unconjugated |
Supplier Page | Shop |