Name | Anti-ZPLD1 antibody |
---|---|
Supplier | Abcam |
Catalog | ab81512 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB ELISA |
Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
Antigen | Synthetic peptide, corresponding to a region within C terminal amino acids 361-410 of Human ZPLD1 (NP_778226); RSDETPTNNSQLGSPSMPPFQLNAITSALISGMVILGVTSFSLLLCSLAL Run BLAST with Run BLAST with |
Description | Rabbit Polyclonal |
Gene | ZPLD1 |
Conjugate | Unconjugated |
Supplier Page | Shop |