Name | Anti-ZWINT antibody |
---|---|
Supplier | Abcam |
Catalog | ab84367 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | ICC/IF ICC/IF IHC-P |
Species Reactivities | Human, Chimpanzee, Monkey |
Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 225-277 ( PEAEAEAENLPDDKPQQPTRPQEQSTGDTMGRDPGVSFKAVGLQPAGDVN LP ) of Human ZWINT (NP_008988 |
Description | Rabbit Polyclonal |
Gene | ZWINT |
Conjugate | Unconjugated |
Supplier Page | Shop |