Anti-ZWINT antibody
| Name | Anti-ZWINT antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab84367 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF ICC/IF IHC-P |
| Species Reactivities | Human, Chimpanzee, Monkey |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 225-277 ( PEAEAEAENLPDDKPQQPTRPQEQSTGDTMGRDPGVSFKAVGLQPAGDVN LP ) of Human ZWINT (NP_008988 |
| Description | Rabbit Polyclonal |
| Gene | ZWINT |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
