Anti-ZXDA antibody
| Name | Anti-ZXDA antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab83092 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ELISA WB |
| Species Reactivities | Human, Bovine, Cat, Pig |
| Antigen | Synthetic peptide corresponding to a region within amino acids 750-799 ( PAKAEWSVHPNSDFFGQEGETQFGFPNAAGNHGSQKERNLITVTGSSFLV ) of Human ZXDA (NP_009087) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | ZXDA |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ZXDA antibody (ab83092) at 1 µg/ml + Human fetal muscle lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution