Name | Anti-ZXDA antibody |
---|---|
Supplier | Abcam |
Catalog | ab83092 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | ELISA WB |
Species Reactivities | Human, Bovine, Cat, Pig |
Antigen | Synthetic peptide corresponding to a region within amino acids 750-799 ( PAKAEWSVHPNSDFFGQEGETQFGFPNAAGNHGSQKERNLITVTGSSFLV ) of Human ZXDA (NP_009087) Run BLAST with Run BLAST with |
Description | Rabbit Polyclonal |
Gene | ZXDA |
Conjugate | Unconjugated |
Supplier Page | Shop |