Anti-ZXDC antibody
| Name | Anti-ZXDC antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab81373 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
| Antigen | Synthetic peptide, corresponding to a region within amino acids 253-302 VYNLKAHMKGHEQESLFKCEVCAERFPTHAKLSSHQRSHFEPERPYKCDF of Human ZXDC, NP_001035743 |
| Description | Rabbit Polyclonal |
| Gene | ZXDC |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ZXDC antibody (ab81373) at 1 µg/ml (in 5% skim milk / PBS buffer) + NTERA2 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution