Anti-ZZZ3 antibody
| Name | Anti-ZZZ3 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab81185 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide, corresponding to a region within internal sequence amino acids 577-626 (EREFKNRKRHTRRVKLVFDKVGLPARPKSPLDPKKDGESLSYSMLPLSD G) of Human ZZZ3, AAH35079 |
| Description | Rabbit Polyclonal |
| Gene | ZZZ3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ZZZ3 antibody (ab81185) at 1 µg/ml + Jurkat cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution