Anti-ARL17B (aa 108-157) polyclonal antibody

Name Anti-ARL17B (aa 108-157) polyclonal antibody
Supplier Creative Diagnostics
Catalog DPABH-19305
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptide corresponding to a region within the internal sequence amino acids 108-157 (CSHVEFGMWKGGRSHPFLPHSSRCAGSGGQLDSILPHQSPAWGPWGCKD L) of Human ARL17B (NP_001034172).
Description Rabbit Polyclonal
Gene ARL17B
Conjugate Unconjugated
Supplier Page Shop