Anti-ASTE1 (aa 609-658) polyclonal antibody

• Supplier: Creative Diagnostics
• Catalog: DPABH-27468
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Mouse
• Antigen: Synthetic peptide within Mouse ASTE1 aa 609-658 (C terminal). The exact sequence is proprietary.Sequence: TKSYAPAELFLPKTKSKSKKKRQKKKVASLGTTADAKHWYDRSNRFGPLM Database link: Q8BIR2 Run BLAST with Run BLAST with
• Description: Rabbit Polyclonal
• Gene: Aste1
• Conjugate: Unconjugated