Anti-C11ORF42 (aa 259-308) polyclonal antibody

Name Anti-C11ORF42 (aa 259-308) polyclonal antibody
Supplier Creative Diagnostics
Catalog DPABH-21221
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptide corresponding to a region within C-terminal amino acids 259-308 (PTPPPQEGPEDKPTRFSYKGRNPFWRGPQILSENWLFSPRSPPPGAQGG G) of Human C11orf42 (NP_775796).
Description Rabbit Polyclonal
Gene C11orf42
Conjugate Unconjugated
Supplier Page Shop