Anti-C9ORF123 (aa 59-108) polyclonal antibody

• Supplier: Creative Diagnostics
• Catalog: DPABH-12381
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptide within Human C9orf123 aa 59-108 (C terminal). The exact sequence is proprietary.Sequence: MGAGGYVYWVARKPMKMGYPPSPWTITQMVIGLSIATWGIVVMADPKGKA Database link: NP_219500.1 Run BLAST with Run BLAST with
• Description: Rabbit Polyclonal
• Gene: TMEM261
• Conjugate: Unconjugated