Name | Anti-CARKD (aa 143-192) polyclonal antibody |
---|---|
Supplier | Creative Diagnostics |
Catalog | DPABH-18279 |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB ELISA |
Species Reactivities | Human |
Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 143-192 (RLHALVVGPGLGRDDALLRNVQGILEVSKARDIPVVIDADGLWLVAQQP A) of Human CARKD; NP_060680 |
Description | Rabbit Polyclonal |
Gene | CARKD |
Conjugate | Unconjugated |
Supplier Page | Shop |