Anti-CARKD (aa 143-192) polyclonal antibody

Name Anti-CARKD (aa 143-192) polyclonal antibody
Supplier Creative Diagnostics
Catalog DPABH-18279
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ELISA
Species Reactivities Human
Antigen Synthetic peptide corresponding to a region within internal sequence amino acids 143-192 (RLHALVVGPGLGRDDALLRNVQGILEVSKARDIPVVIDADGLWLVAQQP A) of Human CARKD; NP_060680
Description Rabbit Polyclonal
Gene CARKD
Conjugate Unconjugated
Supplier Page Shop