Anti-CPNE2 (aa 20-69) polyclonal antibody

Name Anti-CPNE2 (aa 20-69) polyclonal antibody
Supplier Creative Diagnostics
Catalog DPABH-28595
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Mouse
Antigen A synthetic peptide corresponding to a region within N terminal amino acids 20-69 (QCCVCKVELSVSGQNLLDRDVTSKSDPFCVLFIEDNGRWMEFDRTETAV N) of Mouse CPNE2 (NP_705727).
Description Rabbit Polyclonal
Gene Cpne2
Conjugate Unconjugated
Supplier Page Shop