Anti-eIF4E1B (aa 20-69) polyclonal antibody

Name Anti-eIF4E1B (aa 20-69) polyclonal antibody
Supplier Creative Diagnostics
Catalog DPABH-26818
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptide corresponding to a region within N-terminal amino acids 20-69 (EKEEEAAERTPTGEKSPNSPRTLLSLRGKARTGGPMEVKLELHPLQNRW A) of Human EIF4E1B (NM_001099408).
Description Rabbit Polyclonal
Gene EIF4E1B
Conjugate Unconjugated
Supplier Page Shop