Anti-FAM108B1 (aa 107-156) polyclonal antibody

Name Anti-FAM108B1 (aa 107-156) polyclonal antibody
Supplier Creative Diagnostics
Catalog DPABH-18657
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptide corresponding to a region within internal amino acids 107-156 (SSFYIGLGSRINCNIFSYDYSGYGASSGKPTEKNLYADIEAAWLALRTR Y) of human FAM108B1 (NP_057098).
Description Rabbit Polyclonal
Gene ABHD17B
Conjugate Unconjugated
Supplier Page Shop