Anti-FAM134A (aa 143-192) polyclonal antibody

Name Anti-FAM134A (aa 143-192) polyclonal antibody
Supplier Creative Diagnostics
Catalog DPABH-19899
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptide corresponding to a region within N terminal amino acids 143-192 (AGSGARPHLLSVPELCRYLAESWLTFQIHLQELLQYKRQNPAQFCVRVC S) of Human FAM143A (NP_077269)
Description Rabbit Polyclonal
Gene FAM134A
Conjugate Unconjugated
Supplier Page Shop