Anti-FAM166A (aa 38-87) polyclonal antibody

• Supplier: Creative Diagnostics
• Catalog: DPABH-12697
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptide within Human FAM166A aa 38-87 (N terminal). The exact sequence is proprietary. (NP_001001710).Sequence: TTGQLLTDPSVQKSPCSVLSPMSKPKFIEDFSQSKPPRVPCQDLTEPYIP Database link: Q6J272 Run BLAST with Run BLAST with
• Description: Rabbit Polyclonal
• Gene: FAM166A
• Conjugate: Unconjugated