Anti-FBXO33 (aa 432-481) polyclonal antibody

Name Anti-FBXO33 (aa 432-481) polyclonal antibody
Supplier Creative Diagnostics
Catalog DPABH-19006
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptide corresponding to a region from internal sequence amino acids 432-481 (IDTSGFPDLSDNRNEDPLVLLAWRCTKLSLLAIHGYTVWAHNLIAIARL R) of Human FBXO33 (NP_976046).
Description Rabbit Polyclonal
Gene FBXO33
Conjugate Unconjugated
Supplier Page Shop