| Name | Anti-FNDC9 (aa 11-60) polyclonal antibody |
|---|---|
| Supplier | Creative Diagnostics |
| Catalog | DPATB-H81476 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 11-60 (TGAIISWSPS EPCLEDYYHI MYRPNWNSIF SGYLRYNFHH EEKVPRTITS) of Mouse Fndc9 (NP_796049). TGAIISWSPSEPCLEDYYHIMYRPNWNSIFSGYLRYNFHH EEKVPRTITS Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | FNDC9 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |