Anti-KIAA1549 (aa 758-807) polyclonal antibody

Name Anti-KIAA1549 (aa 758-807) polyclonal antibody
Supplier Creative Diagnostics
Catalog DPABH-11086
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptide corresponding to a region within C-terminal amino acids 758-807 (QVPRTSGREPSAPSGNLPHRGLQGPGLGYPTSSTEDLQPGHSSASLIKA I) of Human KIAA1549 (AAH38232).
Description Rabbit Polyclonal
Gene KIAA1549
Conjugate Unconjugated
Supplier Page Shop