Anti-LRRC17 (aa 142-191) polyclonal antibody

• Supplier: Creative Diagnostics
• Catalog: DPABH-13063
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptide within Human LRRC17 aa 142-191 (internal sequence). The exact sequence is proprietary. (NP_005815)Sequence: KVLTEEVFIYTPLLSYLRLYDNPWHCTCEIETLISMLQIPRNRNLGNYAK Database link: Q8N6Y2-2 Run BLAST with Run BLAST with
• Description: Rabbit Polyclonal
• Gene: LRRC17
• Conjugate: Unconjugated