Anti-MAGED4B (aa 47-148) polyclonal antibody

• Supplier: Creative Diagnostics
• Catalog: DPABH-12036
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: IHC-P WB
• Species Reactivities: Human
• Antigen: Recombinant fragment corresponding to Human MAGD4 aa 47-148. This sequence corresponds to aa 469-572 of Isoform 4 (Uniprot: Q96JG8-4).Sequence: HLKEIDKEEHLYILVCTRDSSARLLGKTKDTPRLSLLLVILGVIFMNGNR ASEAVLWE ALRKMGLRPGVRHPFLGDLRKLITDDFVKQKNPELREETP LSMAPS Dat
• Description: Rabbit Polyclonal
• Gene: MAGED4B
• Conjugate: Unconjugated