Name | Anti-ODR4 (aa 275-324) polyclonal antibody |
---|---|
Supplier | Creative Diagnostics |
Catalog | DPABH-29129 |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Rat |
Antigen | Synthetic peptide corresponding to a region within C-terminal amino acids 275-324 (SGSVNLRGNVRCRAYIHSNRPKVKDAVQAVKRDILNTVADRCEILFEDL L) of Rat ODR4 according to XP_222746. |
Description | Rabbit Polyclonal |
Gene | C1orf27 |
Conjugate | Unconjugated |
Supplier Page | Shop |