Anti-ODR4 (aa 275-324) polyclonal antibody

Name Anti-ODR4 (aa 275-324) polyclonal antibody
Supplier Creative Diagnostics
Catalog DPABH-29129
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Rat
Antigen Synthetic peptide corresponding to a region within C-terminal amino acids 275-324 (SGSVNLRGNVRCRAYIHSNRPKVKDAVQAVKRDILNTVADRCEILFEDL L) of Rat ODR4 according to XP_222746.
Description Rabbit Polyclonal
Gene C1orf27
Conjugate Unconjugated
Supplier Page Shop