Anti-OR13C5 (aa 46-95) polyclonal antibody

• Supplier: Creative Diagnostics
• Catalog: DPABH-15088
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptide within Human OR13C5 aa 46-95 (N terminal). The exact sequence is proprietary.Sequence: ILISILDPHLHTPMYFFLGNLSFLDICYTTTSIPSTLVSFLSERKTISLS Database link: Q8NGS8 Run BLAST with Run BLAST with
• Description: Rabbit Polyclonal
• Gene: OR13C5
• Conjugate: Unconjugated