Anti-POP4 (aa 172-220) polyclonal antibody

• Supplier: Creative Diagnostics
• Catalog: DPABH-16330
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC-P ELISA
• Species Reactivities: Human
• Antigen: The region of Human POP4 from which the exact immunogen sequence was derived is amino acids 172-220 EDRLKVIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAKKFKAKGTIDL. The exact sequence is proprietary information.
• Description: Rabbit Polyclonal
• Gene: POP4
• Conjugate: Unconjugated